SSGCID - MygeA.19989.a 50S ribosomal protein L35 MG_197

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10543CompleteStructure predictionssgcidSSGCID - MygeA.19989.a 50...594 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .    
   sequence: MKTKSAAVKRFKLTKSGQIKRKHAYTSHLAPHKSTKQKRHLRKQATVSNSELKRIGILI
    psipred: ----------EEE-----EE-----------------HH------EE-HHHHHHHHHH-
    spider3: ----------EEE-----EEE------E--------HHHH--------HHHHHHHHH--
 deepconcnf: ---------EEEE-----EEE--HHHHH--------------------HHHHHHHHHH-
   disopred: DDD---------------------------DDDDDDDDDDDDDDD--------------
      tmhmm: -----------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10929110.79comparative modeling1-595910 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington