SSGCID - MygeA.19989.a 50S ribosomal protein L35 MG_197 Domain 1 Parse 1 Confidence: 0.79

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10543CompleteStructure predictionssgcidSSGCID - MygeA.19989.a 50...594 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10929110.79comparative modeling1-595910 Nov 2019
             1   .   10    .   20    .   30    .   40    .   50    .    
   sequence: MKTKSAAVKRFKLTKSGQIKRKHAYTSHLAPHKSTKQKRHLRKQATVSNSELKRIGILI
 deepconcnf: ---------EEEE-----EEE--HHHHH--------------------HHHHHHHHHH-
    psipred: ----------EEE-----EE-----------------HH------EE-HHHHHHHHHH-
    spider3: ----------EEE-----EEE------E--------HHHH--------HHHHHHHHH--
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington