SAC PAR-4

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
8343Domain parse completeStructure prediction oozzcar.aqSAC PAR-45911 Sep 201912 Oct 2019
             1   .   10    .   20    .   30    .   40    .   50    .    
   sequence: GKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQ
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: -----------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.12comparative modeling1-5959-
-12n/aab initio1-5959-



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington