Test_1ywj

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
8339CompleteStructure prediction flaviellebmTest_1ywj4111 Sep 201914 Oct 2019
             1   .   10    .   20    .   30    .   40 
   sequence: GSRRASVGSAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDD
    psipred: --------------EEEE-----EEEEE-----EE------
    spider3: --------------EEEE-----EEEEE-----EEEE----
 deepconcnf: --------------EEEE-----EEEEE-----EEEE----
   disopred: DDDDDDDDDDDDDDDD------------------D--DDDD
      tmhmm: -----------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
8307110.47ab initio1-414112 Sep 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington