BMRF2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
8333Domain parse completeDomain predictiondebanjanBMRF235711 Sep 201912 Oct 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  
   sequence: MFSCKQHLSLGACVFCLGLLASTPFIWCFVFANLLSLEIFSPWQTHVYRLGFPTACLMAVLWTLVPAKHAVRAVTPAIMLNIASALIFFSLRVYSTSTWVSAPCLFLANLPLLCLWPRLAIEIVYICPAIHQRFFELGLLLACTIFALSVVSRALEVSAVFMSPFFIFLALGSGSLAGARRNQIYTSGLERRRSIFCARGDHSVASLKETLHKCPWDLLAISALTVLVVCVMIVLHVHAEVFFGLSRYLPLFLCGAMASGGLYLGHSSIIACVMATLCTLTSVVVYFLHETLGPLGKTVLFISIFVYYFSGVAALSAAMRYKLKKFVNGPLVHLRVVYMCCFVFTFCEYLLVTFIKS
   disopred: DDDDDD-D------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: --------TTTTTTTTTTTTTTTTTTTTTTT--------------TTTTTTTTTTTTTTTTTTTT----TTTTTTTTTTTTTTTTTTTT---------TTTTTTTTTTTTTTTTTTTTTTT------------TTTTTTTTTTTTTTTTTTT----TTTTTTTTTTTTTTTTTTTTTTT--------------------------------------TTTTTTTTTTTTTTTTTTTTTTT------------------------TTTTTTTTTTTTTTTTTTTTTTT-----------TTTTTTTTTTTTTTTTTTTTTTT---------TTTTTTTTTTTTTTTTTTTTTTT----

Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.08comparative modeling1-9797-
-210.04comparative modeling94-267174-
-310.08comparative modeling264-35794-
-12n/aab initio1-9797-
-22n/aab initio94-267174-
-32n/aab initio264-35794-



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington