NusA

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
8314Domain parse completeDomain predictionpoonam_katochNusA9111 Sep 201911 Oct 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90 
   sequence: MSMDFIEALNELEREKGISKDIIFEAIEAALISSYKRNFNTAQNVRVDMNRHTGAIKVFARKLVVEEVLDPRTEISLPAAREINPNFQLED
   disopred: D-----------------------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.92comparative modeling1-9191-



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington