tyuio

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7249CompleteStructure prediction simatyuio14614 Aug 201914 Sep 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    . 
   sequence: VEWSASERSTITSLWGKINVAEIGPQALARVLIVYPWTQRYFGKFGDLSNAAAIQGNAKVAAHGKVVLGALEKAVKNMDDVKGTYSKLSQLHNEKLNVDPDNFRLLGDCLTIVLATKLGAGFPAEIQAVWQKFVAVVVSALSKQYF
 deepconcnf: ----HHHHHHHHHHH-------HHHHHHHHHHHH---HHHHH--------HHHH---HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH----
    psipred: ----HHHHHHHHHHHHH--HHHHHHHHHHHHHHH---HHHH---------HHHH---HHHHHHHHHHHHHHHHHHH-HH-HHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHH-
    spider3: ----HHHHHHHHHHHH---HHHHHHHHHHHHHHH-HHHHHH---------HHHH---HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHH--
   disopred: D--------------------------------------------------DDDDDDD----------------------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7474111.00comparative modeling1-14614614 Aug 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington