9911A

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7244CompleteStructure prediction keunwan9911A9513 Aug 201914 Sep 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
   sequence: SGLVVMVLANNEDVKSVNDLDGKVVAVKSGTGSVKYAKAYIKTKDLLIFPNIDNAYMELATNRADTVLHDKANILYFIKTAGNGKFKAVYLVQYM
    psipred: ---EEEEE--------HHH----EEEEE---HHHHHHHHH-----EEE---HHHHHHHHH-----EEEE--HHHHHHHHH-----EEEE------
    spider3: --EEEEEE--------HHHH---EEEEE--HHHHHHHHHH-----EEE---HHHHHHHHH-----EEEE-HHHHHHHHHH-----EEEE------
 deepconcnf: --EEEEEE---------------EEEEE---HHHHHHHHH----EEEEE--HHHHHHHHH-----EEEEEHHHHHHHHHHH----EEEEE-----
   disopred: ---------------------------------------------------------------------------------------------DD
      tmhmm: -----------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7469110.98comparative modeling1-959514 Aug 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington