5zcy_new_NRB

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7237CompleteStructure prediction chuanqisun5zcy_new_NRB9013 Aug 201914 Sep 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
   sequence: VLKEQQRIKVYIERGCDIFCSSRRQEVKTIIEGIDEKEFDLEEIAKKLEAKLQCGGTAKNGRIELQGDHRDRIKKLLAELGFSEELIEVE
    spider3: --HHH-EEEEEEE-------------EEEEEE-----HHHHHHHHHHHHHH----EEEE--EEEEE-HHHHHHHHHHHH----EEEEEE-
 deepconcnf: ------EEEEEEE-------------EEEEEE-----HHHHHHHHHHHHHHH---EEEE--EEEEE---HHHHHHHHHH---EEEEEE--
    psipred: ------EEEEEEE-------------EEEEEE-----HHHHHHHHHHHHHHH---------EEEE---HHHHHHHHHHH-----EEEEE-
   disopred: DDD------------DDDDDD---------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7459110.82ab initio1-909013 Aug 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington