PericarpColor1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7231Domain parse completeStructure prediction chuyihsuPericarpColor133513 Aug 201912 Sep 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
   sequence: MGRAPCCEKVGLKRGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADVKRGNISKEEEDIIIKLHATLGNRWSLIASHLPGRTDNEIKNYWNSHLSRQIHTYRRKYTAGPDDTAIAIDMSKLQSADRRRGGRTPGRPPKASASRTKQADADQPGGEAKGPAAAASSPRHSDVVNPGPNQPNSSSGSTGTAEEEGPSSEDASGPWVLEPIELGDLVWGEADSEMDALMPIGPGGHDSAALEGLGAVGCEAQVDDLFDMDWDGFAAHLWGGPEQDEHSAQLRQAAEPLEVAAAAAAATAARTPDDRELEAFETWLLSDSF
   disopred: DDD------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-----------------------------------DDDDDDDDDD-----------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-------------
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.16comparative modeling1-335335-
-12n/aab initio1-335335-



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington