SignalpeptideHIV-ENV

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7230CompleteStructure prediction JoselineSignalpeptideHIV-ENV4513 Aug 201914 Sep 2019
             1   .   10    .   20    .   30    .   40    .
   sequence: MRVKEKYQHLWRWGWKWGTMLLGMLMICSATEKLWVTVYYGVVPV
    psipred: ---HHH-HHHHH--HHHHHHHHHHHHHEE----EEEEEEE-----
    spider3: --HHHHHHHHHHHHHHHHHHHHHHHHHHH-----EEEE-------
 deepconcnf: --HHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEEEE-----
   disopred: DD-------------------------------------------
      tmhmm: --------------------TTTTTTTTTTTTTTTTTTTTTTT--
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7454110.25comparative modeling1-454513 Aug 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington