RNI09446

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7225CompleteStructure prediction bsssbRNI0944615113 Aug 201913 Sep 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150 
   sequence: PSGILEVDPMSVSNNTKINITVLYEVGESLNNGTVEMDIPSEFIVNNLTDIISISNNSTTVSENSKASYDANNVLSVENLNINKADFVNLTLTNYSVNSSGSYNFAASSMDTGKEMSDKVYATFTVYNDNAYLKNLSASKGDVDPSFDSTV
    spider3: ----------------EEEEEEEEEE-------EEEEE----EEE----EEEEE----EEE------EE----EEEEE--------EEEEEEEEEE------EEEEE------------EEEEEEEE----EE------------------
 deepconcnf: ----EEE--E------EEEEEEEEEE--EEE--EEEEE---HHEE------EEE-----EE-------E----EEEEEEE------EEEEEEEEEEE-----EEEEE-----------EEEEEEEEE--HHHHHH----------------
    psipred: ----EEE--EE-----EEEEEEEEE---------EEE---HHHHH--HHHEEEE----EEE------------EEEEE-----HHHEEEEEEEEEEE------EEEE------HHH---EEEEEEEE---HHHHH----------------
   disopred: DD------------------------------------------------------DDDDDDDDDDDDDDD-----------------------------------DDDDDDDD-------------------------DDDDD-DDDDDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7443110.61comparative modeling1-15115113 Aug 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington