Sequence_1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7210CompleteStructure prediction flaviellebmSequence_13412 Aug 201912 Sep 2019
             1   .   10    .   20    .   30    
   sequence: FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC
 deepconcnf: --HHHHHHHHHHH------HHHHHHHHHHHHH--
    psipred: --HHHHHHHHHHH------HHHHHHHHHHHHH--
    spider3: --HHHHHHHHHHH------HHHHHHHHHHHHH--
   disopred: DDDDD--D-------------------DDDDDDD
      tmhmm: ----------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7430110.92ab initio1-343413 Aug 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington