SSGCID - BupsA.00074.a organic hydroperoxide resistance protein

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
7114CompleteStructure predictionssgcidSSGCID - BupsA.00074.a or...1399 Aug 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .    
   sequence: MNILYKTAATSTGGRDGRATSHDQKLDVKLSAPRELGGAGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTTVTAEVGIGPNEEGGFALDVELRVALPGLDAAAAKTLVDRAHHVCPYSNATRNNVAVRLVVA
 deepconcnf: --EEEEEEEEEE----EEEEE---EEEEEEE--------------HHHHHHHHHHHHHHHHHHHHHHH---------EEEEEEEEEE----EEEEEEEEEEEE----HHHHHHHHHHHHHH----------EEEEEEE-
    psipred: ---EEEEEEEE-------EE-----EEEEEE--HH----------HHHHHHHHHHHHHHHHHHHHHHH---------EEEEEEEE-------EEEEEEEEEE-----HHHHHHHHHHH-------------EEEEEEE-
    spider3: --EEEEEEEEEE-----EEE-----EEEEE---HH----------HHHHHHHHHHHHHHHHHHHHHHH---------EEEEEEEE-------EEEEEEEEEEE----HHHHHHHHHHHHH--HHHHH------EEEEE-
   disopred: -------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7647110.96comparative modeling1-13913920 Aug 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington