2018-07-28_00000055_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
552CompleteStructure predictionrobetta_beta2018-07-28_00000055_1_1923528 Jul 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
   sequence: VSQIYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLDGELIGFDGEFYRLRSDGTATPVQNGDRSPFCSFTFFTPDMTHKIDAKMTREDFEKEINSMLPSRNLFYAIRIDGLFKKVQTRTVELQEKPYVPMVEAVKTQPIFNFDNVRGTIVGFLTPAYANGIAVSGYHLHFIDEGRNSGGHVFDYVLEDCTVTISQKMNMNLRLPNTADFFNANLDNPDFAKDIETTEGS
 deepconcnf: --EEEEEHHHHHHH-------EE----------EEE------EEEEEE--EEEEE-----EEE--------EEEEEE----EEEE------HHHHHHHHHHH-----EEEEEEEEEEEEEEEEEEE---------HHHHHH---EEEEEEEEEEEEEEE-------EEE--EEEEEEE-----EEEEEEEEE--EEEEEEEE-EEEEE----------------HHHHHHHHH--
    psipred: --EEEEHHHHHHHHHHH----EEHHHHHH--------------EEEEE--EEEEE-----EEE---------EEEEE----EEEE------HHHHHHHHHHH-----EEEEEEEEEEE--EEEEE----------HHHHH----EEEE---EEEEEEEE--HH-------EEEEEEE--------EEEEEEE-EEEEEEEE---EEEE----HHHHH-------HHHHHHHHH--
    spider3: --EEEEE-HHHHHH--------EHHHHHH---EEE-------EEEEEE--EEEEE-----EEE---------EEEEEE---EEEEE-----HHHHHHHHHHH-----EEEEEEEEEEE-EEEEEE----------HHHHH----EEEEEEEEEEEEEEE-HHHH-------EEEEEEE------EEEEEEEEEEEEEEEEEE-EEEEE----HHHHH-------HHHHHHHHH--
   disopred: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
795110.99comparative modeling1-23523528 Jul 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington