2018-07-28_00000047_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
551CompleteStructure predictionrobetta_beta2018-07-28_00000047_1_193628 Jul 2018-
             1   .   10    .   20    .   30    . 
   sequence: GDCHKFLGWCRGEKDPCCEHLTCHVKHGWCVWDGTI
 deepconcnf: ---------------------EE------E------
    psipred: --HHHHHHHH----------EEEEEE--EEEE----
    spider3: ---------------------EEE----EEEE----
   disopred: DD----------------------------------
      tmhmm: ------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
792110.87comparative modeling1-363628 Jul 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington