2018-07-28_00000005_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
544CompleteStructure predictionrobetta_beta2018-07-28_00000005_1_1910728 Jul 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  
   sequence: GIDPFTGAAAGVSAAGIEPDLTAIWQALFALPAVGRHQDFFALGGDSQLGLRMLAQLRERHGVDLPLRCLYEAPTVARLAETIVRLAAPAPSGDQDDASEYEEGVIR
 deepconcnf: ----------------HHHHHHHHHHHHH----EE----------HHHHHHHHHHHHHHHH-----HHHH-----HHHHHHHHHHHH------------HHH-----
    psipred: ---------------HHHHHHHHHHHHHH----------------HHHHHHHHHHHHHHHH-----HHHHH----HHHHHHHHHHH------------HHHHHH---
    spider3: ---------------HHHHHHHHHHHHH-----------HHH--HHHHHHHHHHHHHHHHH-----HHHHHH--EHHHHHHHHHHHHH---------HHHHHHH---
   disopred: DDDDDD-DDD------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDD---D
      tmhmm: -----------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
786110.71comparative modeling1-10710728 Jul 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington