T1013_insertion

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
542CompleteStructure predictioncaspT1013_insertion19627 Jul 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    . 
   sequence: KVKSASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDDTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVWSSKRKKS
 deepconcnf: --------EEEEEE----EEEEEE----EEEEEE-----EEEEEEE-------EEEEEEEEE-----EEEEEEEE----EEEEEEEE---------EEEEEEEE--EEEEEEEE------EEE-----EEEEEEEE----------EEEHHHHHHHHHH----------EEEEEEEE-----EEEEEEEE------
    psipred: -------EEEEEEE-----EEEE-----EEEEEEE----EEEE----------EEE----EE-----EEEEEEE------EEEEEE--------------EEEE----EEEEEEEEEE----------EEEEEEEE----------EEEHHHHHHHHHHH---------EEEEEEEEE------EEEE--------
    spider3: -------EEEEEEE----EEEEEE----EEEEEEE----EEEEEEE------EEEEEEEEEE-----EEEEEEEEE-----EEEEE-----------EEEEEEE---EEEEEEEEEE-----------EEEEEEEE----------EEEHHHHHHHHHH---E------EEEEEEEE-----EEEEEEE-------
   disopred: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD-DDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
783110.94comparative modeling1-19619627 Jul 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington