2018-07-21_00000077_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
532CompleteStructure predictionrobetta_beta2018-07-21_00000077_1_199621 Jul 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    . 
   sequence: MNKKSKQQEKLYNFIIAKSFQQPVGSTFTYGELRKKYNVVCSTNDQREVGRRFAYWIKYTPGLPFKIVGTKNGSLLYQKIGINPCNNSTPSKGGDC
 deepconcnf: ---HHHHHHHHHHHHHHHHH---------HHHHHHHH-----HHHHHHHHHHHHHHHHH-----EEEEE-----EEEEE-----------------
    psipred: ---HHHHHHHHHHHHHHHH-------EEEHHHHHHHH-----HHHHHHHHHHHHHHHHH-----EEEE------EEEEE-----------------
    spider3: -----HHHHHHHHHHHHHHH------EE-HHHHHHH------HHHHHHHHHHHHHHHHH-----EEEE------EEEEE-----------------
   disopred: DDDDDDDDDD-------------------------------------------------------------------------DDDDDDDDDDDDD
      tmhmm: ------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
768110.68comparative modeling1-969621 Jul 2018
76912n/aab initio1-969621 Jul 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington