huichon_123

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4123CompleteStructure prediction chenleihuichon_12315616 May 201916 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    . 
   sequence: MAFQLCLILFATSVLAQEYKGMGVETRTTETPLRKHFNLTPVGSQGIRLSWEVQHLSDLKGTDISLKAVNPSDPLVYKRQTAKFSDGQLTIGELKPSTLYKMTVEAVKAKKTILGFTVDIETPRAGKKESTVMTSGSALTSAIAGFVFSCIVVVLT
    psipred: --EEEEEHHHHHHHHH--------------------EEEEE----EEEEEEE----------EEEEEEEE-------EEEEEE----EEEE-------EEEEEEEEE----EEEEE--EEE--------------HHHHHHHHHHHHHHHHHHEE-
    spider3: HHHHHHHHHHHHHHHHH-------------------EEEEE----EEEEEEE----------EEEEEEE-------EEEEEEE----EEEEE------EEEEEEEEEE--EEEEEEEEEEE--------------HHHHHHHHHHHHHHHHHHH--
 deepconcnf: -HHHHHHHHHHHHHHH--------EE----------EEEEEE---EEEEEEE----------EEEEEEE--------EEEEEE----EEEE-------EEEEEEEEEE--EEEEEEEEEEE-------------HHHHHHHHHHHHHHHHHHHH--
   disopred: ----------------DDDDDDDDDDDDDDD-----------------------------------------------------------------------------------------------DDDDDDD-----------------------
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------TTTTTTTTTTTTTTTTTTTTTTT-
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4288110.52comparative modeling1-15615616 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington