730

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4115CompleteStructure predictionMehmet73017516 May 201918 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
   sequence: MTSPEAPRNNPPEQDASELSFTNDPRWKQTIARFSDYASAQAAVDRLSDAGFPVERVAIVGLDVRVVEHVLGRLTGGKAALRGAATGAWFGVLLGLLFGLFAPGFGWLAIMIISVVSGAVWGALLSFLGHLATGGRRDFDSLQTLEAGHYEVQVEAPYAAEAARLLADQTAHPGD
    psipred: ----------------------------EEEEEE--HHHHHHHHHHHHH-----HHEEEEEE-----EEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHEE---EEEEE-HHHHHHHHHHHHH-------
    spider3: ----------------------------EEEEEE--HHHHHHHHHHHHH----HHHEEEEE-----HEEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------EEHHEEE---EEEEE-HHHHHHHHHHHH--------
 deepconcnf: ----------------------------EEEEEE--HHHHHHHHHHHHH-------EEEEE------EEE------HHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHH---EEEEE-HHHHHHHHHHHH--------
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD--------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDD
      tmhmm: -------------------------------------------------------------------------------TTTTTTTTTTTTTTTTTTTTTTT----TTTTTTTTTTTTTTTTTTTTTTT----------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4340110.50comparative modeling1-17517517 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington