C8CHM0 P23-77 VP22

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4114CompleteStructure prediction hlottaC8CHM0 P23-77 VP229216 May 201915 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90  
   sequence: MDGKTLLLVLLGGGVAAYLAYSLAKRAPASPSSGGGTGDAGQTPPAVVDYGDAGAGLGFGLGNLGQDALCRVAPSLCSWWWNPAPQPAPTLW
 deepconcnf: --HHHHHHHHHHHHHHHHHHHHHHH--------------------EEEE---------------HHHHHHHH-HHHH---------------
    psipred: ---HHHHHHHH---HHHHHHHHHH---------------------EEEE----------------HHHHHHH-HHHH---------------
    spider3: ----HEEHHHH---HHHHEHHHH-------------------------------------------HHHEEE--------------------
   disopred: DDD------------------DDDDDDDDDDDDDDDDDDDDDDDDD----------------------------------------------
      tmhmm: ------TTTTTTTTTTTTTTTTTT--------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4278110.22ab initio1-929216 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington