Caveolina 1 AB

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4113CompleteStructure prediction waurregomCaveolina 1 AB17816 May 201916 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .   
   sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
    spider3: -------------------------------HHHHHHHHHH--------------------------HHHHE--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------
 deepconcnf: ------------EE-----------------HHHHH----HH--------E-----------EEEEEHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---EEEE----
    psipred: ---------------------------------------HHHH--------------------EE--EEEEEE--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--EEEEE----
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD----------------------------------------------------------------------------------------------------------------------------DDDDD
      tmhmm: ------------------------------------------------------------------------------------------------TTTTTTTTTTTTTTTTTTTTTTT-----------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4275110.26ab initio1-17817816 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington