FTSQ

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4111CompleteStructure prediction sdey8@uic.eduFTSQ9915 May 201920 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .    
   sequence: MTEHNEDPQIERVADDAADEEAVTEPLATESKDEPAEHPEFEGPRRRARRERAERRAAQARATAIEQARRAAKRRARGQIVSEQNPAKPAARGVVRGLK
    psipred: ---------HHHH------HHHH---------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------------HHHHHHH---
    spider3: -------------------HHH----------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------------
 deepconcnf: ---------HHHH------------------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHH----
   disopred: DDDDDDDDDDD--------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD------D
      tmhmm: ---------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4273110.19comparative modeling1-999915 May 2019
4460120.35ab initio1-999921 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington