T7_h

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4094CompleteStructure prediction Hanna_DudT7_h5515 May 201916 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .
   sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
    psipred: -----HHHHHHHHHHHHHHHEEEEEEEHHHHHHEEEE-----------HHHHH--
    spider3: -----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHHH--
 deepconcnf: -----HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHH-----------HHHHH--
   disopred: DDDDDDDD-----------------------------------------------
      tmhmm: --------------------TTTTTTTTTTTTTTTT-------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4255110.33comparative modeling1-555515 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington