sp02143

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4093CompleteStructure prediction ramki.rpcrsp0214314215 May 201915 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140  
   sequence: SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
    psipred: --------------------------HHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHHHH----EE-HHHHHHHH---HHHHHHH---EE----------HHH---------------------------
    spider3: --------------------------HHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHH---HHHHHHH---EE--------HHHHH---------------------------
 deepconcnf: ------------------H----HHHHHHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHH---HHHHHHH---EE--------HHHHH---------------------------
   disopred: DDDDDDDDDDDDDDDDDDDDDD-----------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4254110.44ab initio1-14214215 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington