KANK3_HUMAN KN motif

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4091CompleteStructure prediction lelinKANK3_HUMAN KN motif4215 May 201915 Jun 2019
             1   .   10    .   20    .   30    .   40  
   sequence: PYSVETPYGFHLDLDFLKYIEELERGPAARRAPGPPTSRRPR
    psipred: --------EEEE---HHHHHHHHH------------------
    spider3: -------------HHHHHHHHHHH------------------
 deepconcnf: -------------HHHHHHHHHHHH-----------------
   disopred: DD--------------------DDDDDDDDDDDDDDDDDDDD
      tmhmm: ------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4251110.29ab initio1-424215 May 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington