2018-05-01_00000973_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
407CompleteStructure predictionrobetta_beta2018-05-01_00000973_1_1914629 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    . 
   sequence: PQAADIVIADAQATPVNHTFVPIGPDPKDATIYWWEDQSQASPAGYWRLSMQLVRPAPAKAGQNTNQRMIRVRVSTFEPILEVAVTATYSGIAPSPTVSYVPKAFTEFVLPERATLDNRKDIRKMHALALTTSEAIAMIESLQFVY
 deepconcnf: ----EEEEE------EEEEEEE---------EEEEEE----------EEEEEEE--------------EEEEEEEEEEEEEEE-------------EEEEEEEEEEEEE------HHHHHHHHHHHHHHHHHHHHHHHHHH-----
    psipred: -----EE----------EEE----------EEEEEE----------EEEEEEEE---------------EEEEEEEEEEEEEEE------------EEEEEEEEEEEEEE-----HHHHHHHHHHHHHHH---HHHHHHHH-----
    spider3: -----EEE----------EEE----------EEEEEE----------EEEEEEE--------------EEEEEEEEEEEEEEE-------------EEEEEEEEEEEEEE-----HHHHHHHHHHHHHHHH-HHHHHHHHHH----
   disopred: -----------------------------------------------------DDDDDDDDDDDDDDDDDD---------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
577110.76comparative modeling1-14614630 Jun 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington