T0998

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
376CompleteStructure predictioncaspT099816621 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    . 
   sequence: SYTQSFGYTIPTEKDTLEIPQYQALLAKKASYMDDSQGKNTATYMNTAAPKDQPETITFGVNKVDNVYKQSNVQNQTFYASSSKGTKIRIDGKRIWRTQSTDVNTGLPVIVDCPLWTSFTLGFADFTLVDDSARKSTIEWMISQLELLKDDGVWSKLCSGVTRIYG
 deepconcnf: ---------------EEE---HHHHHHHHH-----------EEEE---------EEEEEEEEEEEEEEE------EEEEEE-----EEEE--EEEEEE---------EEEEEE----EEEEE---------HHHHHHHHHHHHHHHH-----HHHHH----EEE--
    psipred: ----------------------HHHHHHHHHH---------EEEE---------EEEEEEE-HHHHHHHH----------------EEEEEEEEEEEE----------EEEE----EEEEE----------HHHHHHHHHHHHHHHHH----HHHHHH----EE--
    spider3: -EEEEE-E-------------HHHHHHHHHH----------EEEE----------EEEEEE-EE--EE---------EE------EEEEEEEEEEEEEE---------EEEE-----EEEEEEEEEE---HHHHHHHHHHHHHHHHHH----HHHHH----EE---
   disopred: DDDD----------------------------DDDDDDDDDD-------D-----------------------DDDDDDDDDDDDDDD-----------------------------------------------------------------------------D
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
554110.14comparative modeling1-16616621 Jun 2018
55512n/aab initio1-16616621 Jun 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington