T0995

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
373CompleteStructure predictioncaspT099533019 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
   sequence: MTSIYPKFRAAAVQAAPIYLNLEASVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTEIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKHLNHQKNEVFTYEDIQYQHGILEEKV
 deepconcnf: -------EEEEEEEE------HHHHHHHHHHHHHHHHH----EEEE-----------------HHHHHHHHHHHHHH-----HHHHHHHHHHHHH--EEEEEEE-----EEEEEEEEE-----EEEEEEE----HHHHHH----------EEE----EEEEEEE-----HHHHHHHHH---EEEEE------HHHHHHHHHHHH---EEEEE-----HHHHHHHHHHHHH-----------EEEE-----EEEE-------EEEEEEE-HHHHHHHHHH-----------EEEEE-------EEE----------HHHHHHHH-------
    psipred: -------EEEEEEE-------HHHHHHHHHHHHHHHHH---EEEE-----------EEE----HHHHHHHHHHHHH------HHHHHHHHHHHHH--EEEEEEEE-----EEEEEEEE-----EEEEEE------HHH-EEE--------EEE-----EEEEEEHHHH-HHHHHHHHH---EEEEE--------HHHHHHHH-----EEEE------HHH---------------------EEEE----------------EEEEEE--HHHHHHHH--------------EEEE--------EE----------HHHHHHHH--HH---
    spider3: -------EEEEEEEE------HHHHHHHHHHHHHHHHH----EEE----------HHHH----HHHHHHHHHHHHH------HHHHHHHHHHHHH--EEEEEEE-----EEEEEEEEE-----EEEEEEE----HHHHHEE----------E-----EEEEEE-HHHH-HHHHHHHHH----EEEE-----HHHHHHHHHHHHH---EEEEEEEE--HHHHHHH---HHHH----------EEEE-----EEE--------EEEEEEE-HHHHHHHHHH------------EEEE--------E-----------HHHHHHH--------
   disopred: DDDDDD-DDDD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
549110.82comparative modeling1-33033019 Jun 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington