2018-06-16_00000063_2_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
369CompleteStructure predictionrobetta_beta2018-06-16_00000063_2_196016 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60
   sequence: MENLAKIRMSQKLACWQQILTTLGTSSMSEQEWNTFFRGFLESWQNPYCIQTSCDPSIPL
 deepconcnf: ---------HHHHHHHHHHHHHH------HHHHHHHHHHHHH-------E----------
    psipred: ---HHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHH-----EEE---------
    spider3: --------HHHHHHHHHHHHHHH------HHHHHHHHHHHHHH---HHHHHH--------
   disopred: DDDDDDDDDDDD--------------------------------------------DD-D
      tmhmm: ------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
539110.09comparative modeling1-606016 Jun 2018
54012n/aab initio1-606016 Jun 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington