2018-06-16_00000062_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
366CompleteStructure predictionrobetta_beta2018-06-16_00000062_1_197816 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   
   sequence: GSTKPFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLRIIVPKGSGSGSGSGS
 deepconcnf: ---------------EEEEEEEE--EEEEEEEE--------EEHHHH---HHHHHHHHHHHH----------------
    psipred: ------------EEEEEEEEEEE--EEEEEEEE----HHH-----HHH---HHHHHHHHHHHH---------------
    spider3: ------------EEEEEEEEEEE--EEEEEEEE-----------HHHHH--HHHHHHHHHHH----------------
   disopred: DDDDD--DDD------------------------------------------------DDDDDDDDDDDDDDDDDDDD
      tmhmm: ------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
535110.62comparative modeling1-787816 Jun 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington