SSGCID - MygeA.00080.a 30S ribosomal protein S12 MG_087

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3078CompleteStructure predictionssgcidSSGCID - MygeA.00080.a 30...13917 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .    
   sequence: MATIAQLIRKPRQKKKVKSKSPALHYNLNLLNKKTTNVYSPLKRGVCTRVGTMTPRKPNSALRKYAKVRLTNGFEVLAYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDTVGVDKRRQQRSAYGAKKPKPKS
 deepconcnf: ---HHHHHH------------HHHHHHH-----------------EEEEEEEE----------EEEEEEE----EEEEEE----------EEEEEE---------EEEEEE----------------------------
    psipred: ---HHHHHH------------HHHHHHHHHH-------------EEEEEEEE-------HHHHHEEEEE-----EEEEE-----------EEEEEE-----------EEEEEEEEE-----------------------
    spider3: ---HHHHHH------------HHHHH-------------------EEEEEEEE--------EEEEEEEEE----EEEEEE--------HHHHEEE------------EEEEEEEEE-----------------------
   disopred: -------DDDDDDDDDDDDDDDDDD---------DDDDD----------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3497110.81comparative modeling1-13913926 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington