SSGCID - MygeA.00004.a 30S ribosomal protein S9 MG_417

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3067CompleteStructure predictionssgcidSSGCID - MygeA.00004.a 30...13217 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130  
   sequence: MDKKSFYGLGRRKSSTAKVYLYQSKDKGKITINHRNPSDYFPNKLVIQDMEQPLELTKLKDNFDINVVVKGGGFTGQAGAIRLGIVRALIKFNPDLKKLLKTKKLTTRDKRAKERKKFGLYGARRAPQFTKR
    psipred: ----EEEEE-----EEEEEEEE------EEEE----HHHH---HHHHHHHH--HHHH-----EEEEEEEEE--HHHHHHHHHHHHHHHHHHH-HHHHHHHHH---------HHHH-----------------
    spider3: -----EEE-----EEEEEEEEE------EEEE--EEHHHH---HHHHHHHHHHHHHH------EEEEEEE---HHHHHHHHHHHHHHHHHHH-HHHHHHHHH-------HHHH-------------------
 deepconcnf: -----EEE------EEEEEEEEE---EEEEEE--EE-------HHHHHH-------------EEEEEEEE---HHHHHHHHHHHHHHHHHHH----HHHHHH---------HHHH-----------------
   disopred: DDD-------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3488110.94comparative modeling1-13213226 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington