SSGCID - MygeA.17919.a 30S ribosomal protein S18 MG_092

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3064CompleteStructure predictionssgcidSSGCID - MygeA.17919.a 30...10517 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
   sequence: MMINKEQDLNQLETNQEQSVEQNQTDEKRKPKPNFKRAKKYCRFCAIGQLRIDFIDDLEAIKRFLSPYAKINPRRITGNCNMHQRHVANALKRARYLALVPFIKD
 deepconcnf: -----------------------------------------------------HHHHHHHHHHH------E---------HHHHHHHHHHHHHHHHH--------
    psipred: ----HHHHHHHH------------------------------------------HHHHHHHHHH------EE--------HHHHHHHHHHHHHHHHHH-------
    spider3: ---------------------------------------------------------HHHHHHH------E---------HHHHHHHHHHHHHHHHHH-------
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---------------------------------------------------------------DD
      tmhmm: ---------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3485110.56comparative modeling1-10510526 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington