SSGCID - MygeA.01474.a 50S ribosomal protein L10 MG_361

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3005CompleteStructure predictionssgcidSSGCID - MygeA.01474.a 50...16217 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160  
   sequence: MVDSKKNKKQQVTDFSNLLSQSKGFVIFDYSGMSAVDATLMRKKLFNKGSKIKIVKNNILRRALKTSNFEGVDESVIKGKIAVAVGINEILETLKVVDSVVKEKELMKFVCGHFDNRIFNSDDLQKIAKLPGRNELYGMFLSVLQAPLRKFLYALQAVRNAK
 deepconcnf: ----HHHHHHHHHHHHHHH----EEEEEE-----HHHHHHHHHHHHH---EEEEEEHHHHHHHHHH--------------EEEEEE---HHHHHHHHHHHHH----EEEEEEEE--EE--HHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHH--
    psipred: ----HHHHHHHHHHHHHHHHH--EEEEEE-----HHHHHHHHHHHHH---EEEEEHHHHHHHHHHH-----HHHHH----EEEEE------HHHHHHHHHHHH----EEEEEEE--EE--HHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHH--
    spider3: ---HHHHHHHHHHHHHHHHH---EEEEE------HHHHHHHHHHHHH---EEEEEEHHHHHHHHHH-------HHH----EEEEEE---HHHHHHHHHHHHHH----EEEEEEE--EE--HHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHH--
   disopred: DDDDDD-DDDD----------------------------------------------------------------------------------------------------------------------------------------------------DDD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3336110.96comparative modeling1-16216222 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington