SSGCID - MygeA.18863.a 30S ribosomal protein S17 MG_160

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3003CompleteStructure predictionssgcidSSGCID - MygeA.18863.a 30...8517 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
   sequence: MKRNQRKQLIGTVVSTKNAKTATVKVTSRFKHPLYHKSVIRHKKYHVHNFGELVANDGDRVQIIETRPLSALKRWRIVKIIERAK
 deepconcnf: -------EEEEEEEE-----EEEEEEEEEEE-----EEEEEE--EEEE-----------EEEEEE----------HHHHHHHH--
    psipred: ------EEEEEEEEE------EEEEEEE---------EEEEE--EEEE-----------EEEEEE---------EEEEEEEEE--
    spider3: ------EEEEEEEEE-----EEEEEEEEEEE------EEEEEEEEEE------------EEEEEEE-------EEEEEEEEEE--
   disopred: DDDD---D----------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3288110.90comparative modeling1-858522 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington