SSGCID - MygeA.01103.a 10 kDa chaperonin MG_393

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3002CompleteStructure predictionssgcidSSGCID - MygeA.01103.a 10...11017 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
   sequence: MNITPIHDNVLVSLVESNKEEVSKKGIITSLASNDKSDANANKGIVIALGAGPAYGKTEKPKYAFGVGDIIYFKEYSGISFENEGNKYKIIGFEDVLAFEKPESGKQRKR
 deepconcnf: --EEE---EEEEEE------------EEE--------------EEEEEEE-------------------EEEEEEE--EEEEE--EEEEEE----EEEEE----------
    psipred: --------EEEEEE------------EEE---------------EEEEE----------EE--------EEEE------EEEE--EEEEEEEHHHEEEEE---HHHH---
    spider3: --EE----EEEEEE------------EE--------------EEEEEEE--------------------EEEE------EEEE--EEEEEE-HHHEEEEE----------
   disopred: D----------------DDDD-------------------------------------------------------------------------------DDDDDDDDDD
      tmhmm: --------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3286110.79comparative modeling1-11011022 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington