SSGCID - MygeA.17929.a 30S ribosomal protein S19 MG_155

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3001CompleteStructure predictionssgcidSSGCID - MygeA.17929.a 30...8717 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .  
   sequence: MSRSSKKGAFVDAHLLKKVIEMNKQAKKKPIKTWSRRSTIFPEFVGNTFSVHNGKTFINVYVTDDMVGHKLGEFSPTRNFKQHTANR
 deepconcnf: ------------HHHHHHHHHHHH------EEEEE-----------EEEEEE--EEEEEEEEE---------EEE--EE--------
    psipred: ------------HHHHHHHHHHHHH-----EEE-------------EEEEEE-------EEE-------------------------
    spider3: ------------HHHHHHHHHHHH-------EEEE-------HH---EEEEE--EEEEEEEE------EEEEEE-------------
   disopred: D------------------DDDDDDDDDDD------------------------------------------------DD-DDDDDD
      tmhmm: ---------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3285110.89comparative modeling1-878722 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington