SSGCID - MygeA.17893.a 50S ribosomal protein L11 MG_081

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
2999CompleteStructure predictionssgcidSSGCID - MygeA.17893.a 50...13717 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  
   sequence: MAKKTVTRIAKINLIGGQAKPGPALASVGINMGEFTKQFNEKTKDRQGETIPCIITAFNDKSFTFVLKTTPVSNLIKQAAKLEKGAKNAKTIVGKISLQQAKEIAQYKLVDLNANTVEAALKMVLGTAKQMGIEVTD
 deepconcnf: -------EEEEEEEE----------------HHHHHHHHHHHH------EEEEEEEEE---EEEEEEE---HHHHHHHHH------------EEE--HHHHHHHHHHH--------HHHHHHHHHHHHHH---EEE-
    psipred: ----HHH-EEEEE------------------HHHHHHHHHHHH------EEEEEEEEE----EEEEE----HHHHHHHHH-----------------HHHHHHHHHHH--------HHHHHHHHHHHHH---EEEE-
    spider3: ----EEEEEEEEEEE-------HHHHH----HHHHHHHHHHHH---------EEEEEE----EEEEE---HHHHHHHHH------------EEEEE-HHHHHHHHHHHHHH-----HHHHHHHHHHHHHH---EE--
   disopred: DD-------------------------------------------------------------------------------DDDDDDDDDDD-------------------------------------------DD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3287110.95comparative modeling1-13713722 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington