SSGCID - MygeA.00328.a 50S ribosomal protein L1 MG_082

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
2996CompleteStructure predictionssgcidSSGCID - MygeA.00328.a 50...22617 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    . 
   sequence: MKKLSKRMQAVTKLIDKNKLYPIQEAFELIKKTAITKFVSSVDIAVSLNLDTTKAEQQLRGAIAFPFSIGKSIRILAITDDEKKASEAGADFVGGLDKIEAIKNGWLDFDLIITSPKFMGALGKLGKLLGTRGLMPNPKTETVTDDVVSAIKAYKKGKKEYRTDSFGNIHLSLGKTDTKTEHLVANAMALIDLIKSKRPSTVKGTYIKNIALTTTMGPSLKVKLPD
 deepconcnf: -----HHHHHHHHHH-------HHHHHHHHHHH-----HHHHHHHHH-----------EEEEEE-------EEEEEEEE--HHHHHH----EEE----HHHHH-------EEEE----HHHHHHHHHHH---------------HHHHHHHHHHH---EEEEE-----EEEEEEEEE--HHHHHHHHHHHHHHHHH------------EEEEE------EEEE---
    psipred: -----HHHHHHHHH--------HHHHHHHHHHH-------EEEEEEE-------HHHH---EEE--------EEEEEEE--HHHHHH----EE-HHHHHHHHH------EEEEE-HHHHHHHH---------------------HHHHHHHHHHH---EEEEE-----EE--EE-----HHHHHHHHHHHHHHHHH--------EEEEEEEEE------EE-----
    spider3: -----HHHHHHHHH--------HHHHHHHHHHH-------EEEEEEE---------HEEEEEEE-------EEEEEEEE--HHHHHH----EE-HHHHHHHHH-------EEEE-HHHHHHHHHHHHHH-----------------HHHHHHHHH---EEEEE-----EEEEEEE----HHHHHHHHHHHHHHHHH---HHH----EEEEEEE------EEE----
   disopred: DDDDDDDDDD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3281110.75comparative modeling1-22622622 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington