SSGCID - MygeA.17889.a 30S ribosomal protein S13 MG_175

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
2992CompleteStructure predictionssgcidSSGCID - MygeA.17889.a 30...12417 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    
   sequence: MARILGIDIPNQKRIEIALTYIFGIGLSSAKTILKKAKINPDKRVKDLSEEELVAIRNAASGYKIEGDLRREIALNIKHLTEIGSWKGIRHRKNLPVRGQRTRTNARTRKGPRKTVANKKIESK
 deepconcnf: --EE--EE-----EEEEEE-------HHHHHHHHHH-------------HHHHHHHHHHHH-------HHHHHHHHHHHHHHH-----------------------------------------
    psipred: -------------EEEEEEEEE----HHHHHHHHHHH------------HHHHHHHHHHHHH-EEE-HHHHHHHHHHHHHHHH----------------------HH-----------------
    spider3: --------------EEEEEEE-----HHHHHHHHHH--------HHH--HHHHHHHHHHHH------HHHHHHHHHHHHHHHH--HHHHHHH--------------------------------
   disopred: --------------------------------------------------------------------------------------------------------------DDDDDDDD-DDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3188110.89comparative modeling1-12412419 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington