2018-06-02_00000039_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
287CompleteStructure predictionrobetta_beta2018-06-02_00000039_1_192082 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .   
   sequence: SEPLVRFKRSVNITKGDLNSWRTGTDPCNGKWFGIYCQKGQTVSGIHVTRLGLSGTINIEDLKDLPNLRTIRLDNNLLSGPLPPFFKLPGLKSLLLSNNSFSGEIADDFFKETPQLKRVFLDNNRLSGKIPASLMQLAGLEELHMQGNQFTGEIPPLTDGNKVLKSLDLSNNDLEGEIPITISDRKNLEMKFEGNQRLCGSPLNIECD
 deepconcnf: -HHHHHHHHH----------------------EEEEE-----EEEEEE------EEE------------EEE--------------------EEEEE--------------------EEE---------------------EEEEE-----E-------------EEEE---------------------------------------
    psipred: -HHHHHHHHH------------------------EE------EEEEEE-----EEE--HHHH-------EEE-----EE-------------EEE----EEEEE---HHH-------EEE----EE-----HHHH------EEE----EEE--------------EEE-------------HHH----HHHH----------------
    spider3: HHHHHHHHHH-------H--------------EEEEE-----EEEEEE-----EEE--HHHH-------EEEEE---EE----HHH------EEEE---EEEEE-------------EEEE----------HHHH------EEEEE--EEEE-------------EEEE----EEEE----HHHH---HHHH----------------
   disopred: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
429110.66comparative modeling1-2082082 Jun 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington