T0980s2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
282CompleteStructure predictioncaspT0980s2521 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50  
   sequence: VNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK
 deepconcnf: ----------HHHHH--H-------------EEEEE-----HHHHHHHHH--
    psipred: ----------HHHHHHHHHHHHHH-------EEEHHHH---HHHHHHHHH--
    spider3: ----------HHHH------HHH--------EEEEEE----HHHHHHHHH--
   disopred: D------------------------------------------------DDD
      tmhmm: ----------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
423110.25comparative modeling1-52521 Jun 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington