T0980s1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
281CompleteStructure predictioncaspT0980s11111 Jun 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110 
   sequence: SLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHFIVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHE
 deepconcnf: -----------EEEEEE--EEEEEEEEE-----------HHHHHHHHHHHHHHHHH--------EE-EEEEEE---------EEEEEE--EEEEE---EEEEEEEE-----
    psipred: ------------EEEEE--EEEEEEEEE------HHH--HHHHHHHHHHHHHHHH-------------EEEEEE--------EEEEEE--EE-----EEEEEEEEE-----
    spider3: ------------EEEEE--EEEEEEEEE-----HHHHHHHHHHHHHHHHHHHHHH-------------EEEEE------EEEEEEEEE--EEE-----EEEEEEEE-----
   disopred: ------------------------------DDDDDDDDDDDD------------------------------------------------------------------DDD
      tmhmm: ---------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
424110.55comparative modeling1-1111111 Jun 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington