T0978

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
279CompleteStructure predictioncaspT097841631 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    . 
   sequence: MSKLKYFFPDSQDFIDPSFDFVRETRNEHRVRQRDDHYPHEVFPHPYDGMLVSKAVVDGLGGGESKYTRAQRLRYFRNGMKHFFRLPDNMQTMGDCGAFTYVNQDVPPYRVEEVIEFYETSRFNYGVSLDHIIFGYEKPGESFSGEVLAECRRRQDITLTLAQDFLVKSQKSCFTPFGVAHGWNKKSYRQSVEALLAMGYKNITMGGMVPLKTAQILETLEEIKPLLKSDTQVHLLGIARPESFADFIRLGVTSIDSTTPLQQAFKDRKNNYHTPEGRAYTAVRVPQFDANPSLSRKIKSGVIDQDVARHLEKDAMHALFEYDNNALSLEKTLEAVLAYERLHSGEKEAEKIRADYERTLGDRPWRKCECNICRSIGINVIIFRGAERNRRRGFHNIQVLYNRLQYTLSLRSEDKS
 deepconcnf: ----EEE-----------------------------------------EEEEE---------------HHHHHHHHH--HHHH-------EEE-----------------HHHHHHHHHH----EEEE--EEEE-------------HHHHHHHHHHHHHHHHHHHHHH----EEEEEEEE---HHHHHHHHHHHHH----EEEE-------HHHHHHHHHHH--------EEEEE-------HHHHHH---------HHHHHHHH-------------EEEEEE------HHHHHHHH-----HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH----HHHHHHHHHHHHH----------HHHHHH--EEEEEE-----------HHHHHHHHHHHHHH-------
    psipred: ----EEE-------------------------------HHH-------EEEEEHHH------------HHHHHHHHH---HHEEE------EE-----------------HHHHHHHHH-----EE----EE---------------HHHHHHHHHHHHHHHHHHHHHH----EEEEEEEE---HHHHHHHHHHHHHH---EEEE--------HHHHHHHHHHHHH-----EEEEE----HHHHHHHHH----EEE---HHHHHH-------------EEEEEE-------HHHHHHHH-----HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH-----HHHHHHHHHHHHHH--------HH------EEEEE----------HHHHHHHHHHHHHHHHH------
    spider3: ----------HHH-------------------------HHHH------EEEEEEEEE-----------HHHHHHHHH--HHHH--------EEE----HHH---------HHHHHHHHHH----EEEE--EEEE------------HHHHHHHHHHHHHHHHHHHHHHH-----EEEEEEE---HHHHHHHHHHHHH----EEEE-------HHHHHHHHHHHHHH-----EEEEEEEE-HHHHHHHHH--EEEEE--HHHHHHH------EE------EEEEE-------HHHHHHHH-----HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHH-HHH----HHHHHH-EEEEEE-------------HHHHHHHHHHHHHH------
   disopred: D----------------------------------------------------------DDDDDDDD-------------------------------------------------------------------------DDDDDDDDD-----------------------------------------------------------------------------------------------------------------------------------------------------DD-------------------------------------------------------------------------------------------------------DDDDDDDDDDDDD
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
422110.55comparative modeling1-4164161 Jun 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington