T0960_segment

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
277CompleteStructure predictioncaspT0960_segment7930 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .    
   sequence: QNWDDGNFDPASYLPKAGFTWAALPGKPATFPPSGHNHDTSQITSGILPLARGGLGANTAAGARNNIGAGVPATASRAL
 deepconcnf: -----------------------------------------------------------HHH---------HHHHH---
    psipred: ---------HHHHHH-------------------------------EEEEE------EEHHHHHEEE---HHHHHH---
    spider3: ---------HHHH--------------------------HHHH---EEHE---------HHHHHHH-----HHEHE---
   disopred: DDDDDD------------------------------------------------------------------DDDD--D
      tmhmm: -------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
418110.02comparative modeling1-797930 May 2018
41912n/aab initio1-797930 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington