T0957s1_dom1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
276CompleteStructure predictioncaspT0957s1_dom17530 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
   sequence: SNSFEVSSLPDANGKNHITAVKGDAKIPVDKIELYMRGKASGDLDSLQAEYNSLKDARISSQKEFAKDPNNAKRM
 deepconcnf: ---EEEEEE------EEEEEEE--EEE----EEEEE-------HHHHHHHHHHHHHHHHHHHHHHH---------
    psipred: ----EEEEE------EEEEEEE--EEEE---EEEEE-------HHHHHHHHHHHHHHHHHHHHHHH---------
    spider3: ----EEEEE------EEEEEEE--EEEEHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHH-HHHHH--
   disopred: DD-----------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: ---------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
416110.06comparative modeling1-757530 May 2018
41712n/aab initio1-757530 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington