T0976

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
275CompleteStructure predictioncaspT097625229 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250  
   sequence: MKIMQHSSGFLKLVDDAKSRIQECSVDDIQKMNETQTLDGLLIDTREESEVANGYIPNAIHLSKGIIESAIESAVPNKNQKMYFYCGGGFRSALVADKLREMGYKNVISVDGGWRAWNAKGYPTVSPNQFRPNEFLKLVNNAKTQIKECSTTELYNKINSQELDGIVFDVREDSEFNRFHIQGATHLSKGQIEVKIENLVPNKQQKIYLYCGSGFRSALAAESLQHMGYTNVVSIAGGIKDWLANNYPVSQN
 deepconcnf: -EEEE-------HHHHHHH------HHHHHHHHHH-----EEEE---HHHHH-------EEE------HHH----------EEEEE----HHHHHHHHHHH-----EEEE---HHHHHH----------------E--------EEEEE-HHHHHHHHH------EEEE---HHHH--------EEE-HHHHHHHHH---------EEEEE---HHHHHHHHHHHH-----EEEE---HHHHHH--------
    psipred: ------------HHHHHH----EEEHHHHHHHHH-----EEEEE---HHHHHH------EE--HHHHHHHHHHHH-----EEEEE------HHHHHHHHHH-----EEEE---HHHHHH----------------------------EE-HHHHHHHHH-----EEEEE---HHH-----------HHHHHHHHHHHHH------EEEEE---HHHHHHHHHHHHH------------HHHH----------
    spider3: HHHHHHH--HHHHHHHHH-----E-HHHHHHHH-------EEEE---HHHHH-----------HHHHHHHHHHH------EEEEE-----HHHHHHHHHHH-----EEEE---HHHHHH---------------------------EEE-HHHHHHHHH------EEEE---HHHHH-------EEE-HHHHHHHHHH--------EEEE--HHHHHHHHHHHHHH------EEE---HHHHHH--------
   disopred: DDDDDDDDDDDDDD--------------------------------------------------------------------------------------------------------------------DDD--------------------------------------------------------------------------------------------------------------------DDD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
414110.53comparative modeling1-25225229 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington