2018-05-26_00000100_2_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
270CompleteStructure predictionrobetta_beta2018-05-26_00000100_2_197026 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70
   sequence: GPGSMCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRLREQD
 deepconcnf: --------HHHHHHHH------HHHHHH-----HHHH----HHHHHH-----HHHHHHHHHHHHHHHH--
    psipred: ---------HHHHHHH---HHHHHHHHH-----HHHHH---HHHHHH-----HHHHHHHHHHHHHHHHH-
    spider3: ---------HHHHHHH--HHHHHHHHHH-----HHHHH---HHHHHH-----HHHHHHHHHHHHHHHH--
   disopred: DDDDDD-DDDD---------------------------------------------------------DD
      tmhmm: ----------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
402110.89comparative modeling1-707026 May 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington